PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_013596921.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Brassica
Family SRS
Protein Properties Length: 349aa    MW: 38274.8 Da    PI: 6.617
Description SRS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_013596921.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF702224.22.6e-691162802154
          DUF702   2 rsgtasCqdCGnqakkdCaheRCRtCCksrgfdCathvkstWvpaakrrerqqqlaaasskaaasa.......aeaaskrkrel......kskkq 83 
                     r+g+++CqdCGnqakkdC h+RCRtCCksrgfdC+thvkstWvpaakrrer++qlaa+ sk++++        ++++ +++r++           
  XP_013596921.1 116 RQGNMNCQDCGNQAKKDCPHMRCRTCCKSRGFDCQTHVKSTWVPAAKRRERRAQLAALPSKRSREPssgggggDDDDYDDDRDDdenggqGGGGG 210
                     7899****************************************************999888877678999993344444444334444455678 PP

          DUF702  84 salsstklssaeskkeletsslPeevsseavfrcvrvssvddgeeelaYqtavsigGhvfkGiLydqGlee 154
                     sal++ ++++a+s+  le ++lP+e+ss+avfrc+rvss+dd++ee+aYqt+v+igGhvfkGiLydqG+++
  XP_013596921.1 211 SALACIRVVNASSS-GLESNHLPPEISSPAVFRCIRVSSIDDDDEEYAYQTVVDIGGHVFKGILYDQGPSD 280
                     89999**9999765.99999************************************************986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF051429.3E-63119279IPR007818Protein of unknown function DUF702
TIGRFAMsTIGR016231.2E-27121163IPR006510Zinc finger, lateral root primordium type 1
TIGRFAMsTIGR016241.0E-27230278IPR006511Lateral Root Primordium type 1, C-terminal
Sequence ? help Back to Top
Protein Sequence    Length: 349 aa     Download sequence    Send to blast
MAGMFNLGGR DNNKQDHLHH HMDKDHNEDK SSNHLYLYKE EIYNNNNRGF EIWPSQYFQQ  60
QQQNHVAPPT NFLSFGMVPS GGSNNNDRSS NRSLYFNVVS DHERIRSSPG RFTVTRQGNM  120
NCQDCGNQAK KDCPHMRCRT CCKSRGFDCQ THVKSTWVPA AKRRERRAQL AALPSKRSRE  180
PSSGGGGGDD DDYDDDRDDD ENGGQGGGGG SALACIRVVN ASSSGLESNH LPPEISSPAV  240
FRCIRVSSID DDDEEYAYQT VVDIGGHVFK GILYDQGPSD HPYSSSPTAA EACQRHINLL  300
ASTALASTST TATNNTKASI DPSSLYTPTA APFSTCITTG TPFFPPPRS
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_013596921.10.0PREDICTED: protein SHI RELATED SEQUENCE 7-like
SwissprotQ9FXH71e-169SRS7_ARATH; Protein SHI RELATED SEQUENCE 7
TrEMBLA0A0D3D8060.0A0A0D3D806_BRAOL; Uncharacterized protein
STRINGAT1G19790.11e-167(Arabidopsis thaliana)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM26452572
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G19790.21e-149SHI-related sequence 7